Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YNL130C-A  from Saccharomyces cerevisiae S288C
>YNL130C-A|YNL130C-A DGR1 SGDID:S000028579, Chr XIV from 381391-381245, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; dgr1 null mutant is resistant to 2-deoxy-D-glucose" ORGANISM: Saccharomyces cerevisiae S288C (48 aa)
MQVGFVSQTNCRSFPACIVFLFQMSQRQRSFNANLRVFKSKCKKIYIG