Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL122C  from Saccharomyces cerevisiae S288C
>YNL122C|YNL122C YNL122C SGDID:S000005066, Chr XIV from 398370-398023, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to mitochondria; YNL122C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (115 aa)
MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKG
TAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH