Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL111C  from Saccharomyces cerevisiae S288C
>YNL111C|YNL111C CYB5 SGDID:S000005055, Chr XIV from 417302-416940, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytochrome b5, involved in the sterol and lipid biosynthesis pathways; acts as an electron donor to support sterol C5-6 desaturation" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG
HSDEALRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGVAYYLLNE