Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL107W  from Saccharomyces cerevisiae S288C
>YNL107W|YNL107W YAF9 SGDID:S000005051, Chr XIV from 420098-420778, Genome Release 64-1-1, Verified ORF, "Subunit of both the NuA4 histone H4 acetyltransferase complex and the SWR1 complex, may function to antagonize silencing near telomeres; interacts directly with Swc4p, has homology to human leukemogenic protein AF9, contains a YEATS domain" ORGANISM: Saccharomyces cerevisiae S288C (226 aa)
MAPTISKRIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIK
KVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPY
ANPVPNSDNGNEQNTTDHNSKDAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSNKTD
DCVYSKQLEQEEIDRIEIGIEKVDKEIDELKQKLENLVKQEAINGS