Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YNL097C-B  from Saccharomyces cerevisiae S288C
>YNL097C-B|YNL097C-B YNL097C-B SGDID:S000028699, Chr XIV from 440919-440797, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (40 aa)
MTAKTKQSWNKGIWENGKQGSHQQTFLPKIWVNIYSTPTS