Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL086W  from Saccharomyces cerevisiae S288C
>YNL086W|YNL086W SNN1 SGDID:S000005030, Chr XIV from 466334-466642, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; likely member of BLOC complex involved in endosomal cargo sorting; green fluorescent protein (GFP)-fusion protein localizes to endosomes" ORGANISM: Saccharomyces cerevisiae S288C (102 aa)
MAGDSISADGTGVHPVELSVYSVLSTDLDGLYQSINELRESQALLILMLRKVRDKLRREG
QVLYDPEPFKPTMDKLADLSARVRILSQRYEELQGNARALNN