Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL081C  from Saccharomyces cerevisiae S288C
>YNL081C|YNL081C SWS2 SGDID:S000005025, Chr XIV from 476619-476188, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative mitochondrial ribosomal protein of the small subunit, has similarity to E. coli S13 ribosomal protein; participates in controlling sporulation efficiency" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MVVHILGKGFKGKEVIKIALASKFYGIGKTTAEKICSKLGFYPWMRMHQLSEPQIMSIAS
ELSTMTIEGDARAIVKDNIALKRKIGSYSGMRHTLHLPVRGQHTRNNAKTARKLNKIDRR
GIHTFSQAKVQHNPSLWSCIFGK