Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL079C  from Saccharomyces cerevisiae S288C
>YNL079C|YNL079C TPM1 SGDID:S000005023, Chr XIV from 479165-478566, Genome Release 64-1-1, reverse complement, Verified ORF, "Major isoform of tropomyosin; binds to and stabilizes actin cables and filaments, which direct polarized cell growth and the distribution of several organelles; acetylated by the NatB complex and acetylated form binds actin most efficiently" ORGANISM: Saccharomyces cerevisiae S288C (199 aa)
MDKIREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKNQQLEDEIEKL
EAGLSDSKQTEQDNVEKENQIKSLTVKNHQLEEEIEKLEAELAESKQLSEDSHHLQSNND
NFSKKNQQLEEDLEESDTKLKETTEKLRESDLKADQLERRVAALEEQREEWERKNEELTV
KYEDAKKELDEIAASLENL