Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL069C  from Saccharomyces cerevisiae S288C
>YNL069C|YNL069C RPL16B SGDID:S000005013, Chr XIV from 494524-493956,495001-494974, Genome Release 64-1-1, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has similarity to Rpl16Ap, E. coli L13 and rat L13a ribosomal proteins; transcriptionally regulated by Rap1p" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MSQPVVVIDAKDHLLGRLASTIAKQVLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKA
TAFNKTRGPFHFRAPSRILYKAIRGMVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVP
QALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEDKRKVRSAEYYAKKRAFTKKVSSA
SAAASESDVAKQLASFGY