Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL052W  from Saccharomyces cerevisiae S288C
>YNL052W|YNL052W COX5A SGDID:S000004997, Chr XIV from 531725-532186, Genome Release 64-1-1, Verified ORF, "Subunit Va of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; predominantly expressed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLP
WAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQD
AKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK