Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL031C  from Saccharomyces cerevisiae S288C
>YNL031C|YNL031C HHT2 SGDID:S000004976, Chr XIV from 576050-575640, Genome Release 64-1-1, reverse complement, Verified ORF, "Histone H3, core histone protein required for chromatin assembly, part of heterochromatin-mediated telomeric and HM silencing; one of two identical histone H3 proteins (see HHT1); regulated by acetylation, methylation, and phosphorylation" ORGANISM: Saccharomyces cerevisiae S288C (136 aa)
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
QKKDIKLARRLRGERS