Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL030W  from Saccharomyces cerevisiae S288C
>YNL030W|YNL030W HHF2 SGDID:S000004975, Chr XIV from 576727-577038, Genome Release 64-1-1, Verified ORF, "Histone H4, core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF1); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity" ORGANISM: Saccharomyces cerevisiae S288C (103 aa)
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG