Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL024C-A  from Saccharomyces cerevisiae S288C
>YNL024C-A|YNL024C-A KSH1 SGDID:S000028698, Chr XIV from 586820-586602, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential protein suggested to function early in the secretory pathway; inviability is suppressed by overexpression of Golgi protein Tvp23p; ortholog of human Kish" ORGANISM: Saccharomyces cerevisiae S288C (72 aa)
MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL
ACILMAISQFNS