Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL015W  from Saccharomyces cerevisiae S288C
>YNL015W|YNL015W PBI2 SGDID:S000004960, Chr XIV from 605384-605611, Genome Release 64-1-1, Verified ORF, "Cytosolic inhibitor of vacuolar proteinase B (PRB1), required for efficient vacuole inheritance; with thioredoxin forms protein complex LMA1, which assists in priming SNARE molecules and promotes vacuole fusion" ORGANISM: Saccharomyces cerevisiae S288C (75 aa)
MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHN
DVIENVEEDKEVHTN