Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR322C  from Saccharomyces cerevisiae S288C
>YMR322C|YMR322C SNO4 SGDID:S000004941, Chr XIII from 919079-918366, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Possible chaperone and cysteine protease, similar to bacterial Hsp31 and yeast Hsp31p, Hsp32p, and Hsp33p; DJ-1/ThiJ/PfpI superfamily member; predicted involvement in pyridoxine metabolism; induced by mild heat stress and copper deprivation" ORGANISM: Saccharomyces cerevisiae S288C (237 aa)
MTPKRALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGGFGWDEHY
LPKSFIGGEDKMNFETKNSAFNKALARIKTANEVNASDYKIFFASAGHGALFDYPKAKNL
QDIASKIYANGGVIAAICHGPLLFDGLIDIKTTRPLIEGKAITGFPLEGEIALGVDDILR
SRKLTTVERVANKNRAKYLAPIHPWDDYSITDGKLVTGVNANSSYSTTIRAINALYS