Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR311C  from Saccharomyces cerevisiae S288C
>YMR311C|YMR311C GLC8 SGDID:S000004928, Chr XIII from 897603-896914, Genome Release 64-1-1, reverse complement, Verified ORF, "Regulatory subunit of protein phosphatase 1 (Glc7p), involved in glycogen metabolism and chromosome segregation; proposed to regulate Glc7p activity via conformational alteration; ortholog of the mammalian protein phosphatase inhibitor 2" ORGANISM: Saccharomyces cerevisiae S288C (229 aa)
MGGILKNPLALSPEQLAQQDPETLEEFRRQVYENTQKNAKLTSHKRNIPGLDNTKEEGEI
IGTSSTFLPKDTLSLKHEQDMLAKMTPEERVQWNQRNLAENEITKKQFQDIHIDEPKTPY
QGAVDPHGEYYRVDDDEDEDNSDKKPCQVANDDIDDLSLGEPEFEIKENKQPDFETNDEN
DEDSPEARHKKFEEMRKKHYDVRAIFNKKSREALKDEDEDEDDSTTKEP