Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR298W  from Saccharomyces cerevisiae S288C
>YMR298W|YMR298W LIP1 SGDID:S000004913, Chr XIII from 863819-864271, Genome Release 64-1-1, Verified ORF, "Ceramide synthase subunit; single-span ER membrane protein associated with Lag1p and Lac1p and required for ceramide synthase activity, null mutant grows extremely slowly and is defective in ceramide synthesis" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MSQPTPIITTKSAAKPKPKIFNLFRVCFISLLLIAAVEYFKYGTRINYEWFHCTPIKEPQ
SGSVIKLWARGGPSCDKRGEYKTIVKRITRDYEPNDEHLSFCIIENDNVPPVHYPIHEDK
GEPGYVAYVGYDTDSELVQELCADSTIYHM