Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR292W  from Saccharomyces cerevisiae S288C
>YMR292W|YMR292W GOT1 SGDID:S000004906, Chr XIII from 854795-854816,854899-855293, Genome Release 64-1-1, Verified ORF, "Homodimeric protein that is packaged into COPII vesicles and cycles between the ER and Golgi; involved in secretory transport but not directly required for aspects of transport assayed in vitro; may influence membrane composition" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MWLTEAQKFGVAFTFGGFLFFLFGIFTFFDRALLALGNILFLIGVFLIIGSQKTYIFFTR
PNKRRGSLFFLVGAFLILLKWTFLGFIIESLGIIGLFGDFFGVIVQFLRSMPIIGPILSH
PAIAPIVDKLAGVRVLPV