Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR286W  from Saccharomyces cerevisiae S288C
>YMR286W|YMR286W MRPL33 SGDID:S000004899, Chr XIII from 841942-842202, Genome Release 64-1-1, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE
HELTPSQQRELRKSNPGFIVEKRTID