Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YMR272W-B  from Saccharomyces cerevisiae S288C
>YMR272W-B|YMR272W-B YMR272W-B SGDID:S000028696, Chr XIII from 811089-811196, Genome Release 64-1-1, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (35 aa)
MRSLVFVQLSLLSWEIFCGERSFVSMKAIFSCMYV