Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR264W  from Saccharomyces cerevisiae S288C
>YMR264W|YMR264W CUE1 SGDID:S000004877, Chr XIII from 795805-796416, Genome Release 64-1-1, Verified ORF, "Endoplasmic reticulum membrane protein that recruits the ubiquitin-conjugating enzyme Ubc7p to the ER where it functions in protein degradation; contains a CUE domain that binds ubiquitin to facilitate intramolecular monoubiquitination" ORGANISM: Saccharomyces cerevisiae S288C (203 aa)
MEDSRLLITLILVFGVIFLKKFFQSNQHPSAQRLSATGVNAHGRPQGSTQNALRRTGRVN
GGHPVTTQMVETVQNLAPNLHPEQIRYSLENTGSVEETVERYLRGDEFSFPPGFEPSRAP
MGANAAVDNNAAGGGEFNDPRKKNMICAENLLDKFHVDLNEDMSNLSFKDLDIEERKRLL
VWQARKNLETKLQSDKDLQSLLT