Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR256C  from Saccharomyces cerevisiae S288C
>YMR256C|YMR256C COX7 SGDID:S000004869, Chr XIII from 779127-778945, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit VII of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain" ORGANISM: Saccharomyces cerevisiae S288C (60 aa)
MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA