Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR252C  from Saccharomyces cerevisiae S288C
>YMR252C|YMR252C YMR252C SGDID:S000004865, Chr XIII from 775719-775315, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to mitochondria; YMR252C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (134 aa)
MFGKVFVSYIRTRIGFKPLSTIYTPVSSSSLSFDKEACFPFKKWHELNMSQKQEFIQRFV
KNYRHQYPSSKTNVSLKGLSIGMDEHNDSPSVFGIFYNDIWKSFKNEQLGTNNDNMKSGS
RFSHPSFKQLLIQK