Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR251W-A  from Saccharomyces cerevisiae S288C
>YMR251W-A|YMR251W-A HOR7 SGDID:S000004864, Chr XIII from 774752-774931, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; overexpression suppresses Ca2+ sensitivity of mutants lacking inositol phosphorylceramide mannosyltransferases Csg1p and Csh1p; transcription is induced under hyperosmotic stress and repressed by alpha factor" ORGANISM: Saccharomyces cerevisiae S288C (59 aa)
MKLSQVVVSAVAFTGLVSAANSSNSSSSKNAAQPIAGLNNGKVAGAAGVALAGALAFLI