Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR244C-A  from Saccharomyces cerevisiae S288C
>YMR244C-A|YMR244C-A YMR244C-A SGDID:S000004857, Chr XIII from 758831-758517, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and nucleus and is induced in response to the DNA-damaging agent MMS; YMR244C-A is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (104 aa)
MGLFSFDGGKKESQPPNTRSQRKLCWESRDAFFQCLDKADILDAMDPKNSKSIKSHCKVE
NEKFEENCAHSWIKYFKEKRVIDFKREQTIKRIEQEAKQRERNQ