Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR242C  from Saccharomyces cerevisiae S288C
>YMR242C|YMR242C RPL20A SGDID:S000004855, Chr XIII from 753742-753225,754220-754220, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (172 aa)
MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVS
INQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAAVETLYQDMAARHRARFRS
IHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPHRVQKSTKTFSYKRPSTFY