Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR230W  from Saccharomyces cerevisiae S288C
>YMR230W|YMR230W RPS10B SGDID:S000004843, Chr XIII from 732414-732465,732876-733141, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPSQRPQRRY