Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR195W  from Saccharomyces cerevisiae S288C
>YMR195W|YMR195W ICY1 SGDID:S000004808, Chr XIII from 654034-654417, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, required for viability in rich media of cells lacking mitochondrial DNA; mutants have an invasive growth defect with elongated morphology; induced by amino acid starvation" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MSSNYATPLDDEVFPLSFANYQFTEHVSLGEHYSLNTSEDAKYNNLNGPFVVPRDTGKFD
LNTSSASDETVFSLDNPQENNYKHQAMNNVQDCRMAVAAKTTQSCDKLTDLYANAAQQNY
RLWLSSF