Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR194W  from Saccharomyces cerevisiae S288C
>YMR194W|YMR194W RPL36A SGDID:S000004807, Chr XIII from 651145-651160,651624-651910, Genome Release 64-1-1, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Bp and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (100 aa)
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDL
IRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH