Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YMR194C-B  from Saccharomyces cerevisiae S288C
>YMR194C-B|YMR194C-B CMC4 SGDID:S000028514, Chr XIII from 652775-652594,652887-652848, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein that localizes to the mitochondrial intermembrane space via the Mia40p-Erv1p system; contains twin cysteine-x(9)-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (73 aa)
MSNPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCCPLPSLLE
LKMKQRKLTPGDS