Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR184W  from Saccharomyces cerevisiae S288C
>YMR184W|YMR184W ADD37 SGDID:S000004796, Chr XIII from 628189-628785, Genome Release 64-1-1, Verified ORF, "Protein of unknown function involved in ER-associated protein degradation; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and is induced in response to the DNA-damaging agent MMS; YMR184W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MAIKPTKSFQNCLEAEVPGYNDCPTVLFSIDPNSGPRSKSKQRTKSKRCVSGRLATEVLD
LYGNTKTATTPPPVLRRPSVTAAQQESACEGVLVKDQGDRQLQPILCSKEELVAKINDLC
VCGSKLSSKELEFYKKKLDSNITKILQNEHTKTVLSQIFNEKDKNMAVKTIKHWMVTDTT
ISNWCPAFLKIFENAMPN