Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR174C  from Saccharomyces cerevisiae S288C
>YMR174C|YMR174C PAI3 SGDID:S000004786, Chr XIII from 610365-610159, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic proteinase A (Pep4p) inhibitor, dependent on Pbs2p and Hog1p protein kinases for osmotic induction; intrinsically unstructured, N-terminal half becomes ordered in the active site of proteinase A upon contact" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTDADESEKHNYQEQYNKL
KGAGHKKE