Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR159C  from Saccharomyces cerevisiae S288C
>YMR159C|YMR159C ATG16 SGDID:S000004769, Chr XIII from 574928-574476, Genome Release 64-1-1, reverse complement, Verified ORF, "Conserved protein that interacts with Atg12p-Atg5p conjugates to form Atg12p-Atg5p-Atg16p multimers, which localize to the pre-autophagosomal structure and are required for autophagy" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH
DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDL
KKEHSQLVARWLKKTEKETEAMNSEIDGTK