Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR150C  from Saccharomyces cerevisiae S288C
>YMR150C|YMR150C IMP1 SGDID:S000004758, Chr XIII from 562528-561956, Genome Release 64-1-1, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial inner membrane peptidase complex, required for maturation of mitochondrial proteins of the intermembrane space; complex contains Imp1p and Imp2p (both catalytic subunits), and Som1p" ORGANISM: Saccharomyces cerevisiae S288C (190 aa)
MTVGTLPIWSKTFSYAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVLKNFQN
GRGIKMGDCIVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIK
VPEGHVWVTGDNLSHSLDSRTYNALPMGLIMGKIVAANNFDKPFWDGSIRNIWGFKWINN
TFLDVQAKSN