Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR148W  from Saccharomyces cerevisiae S288C
>YMR148W|YMR148W OSW5 SGDID:S000004756, Chr XIII from 560366-560812, Genome Release 64-1-1, Verified ORF, "Protein of unknown function that may play a role in spore wall assembly; predicted to contain an N-terminal transmembrane domain; osw5 null mutant spores exhibit increased spore wall permeability and sensitivity to beta-glucanase digestion" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MVSTATFFFFVYLTLFVVIGFFSSLFIIPLLGISFVFAIGVVSFGFCSNMSFKMAQLIYV
RADAFLKKVLDKMALQTQPAQLQEPQEPLSTLRPVSNPTIPSPLRQTARPSKFVTEEDVI
FEPVSAQSAIARSLETTANKAGNKFQLS