Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR143W  from Saccharomyces cerevisiae S288C
>YMR143W|YMR143W RPS16A SGDID:S000004751, Chr XIII from 551928-551951,552496-552903, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Bp and has similarity to E. coli S9 and rat S16 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKF
SNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIAD
SRRPEPKKFGGKGARSRFQKSYR