Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YMR123W  from Saccharomyces cerevisiae S288C
>YMR123W|YMR123W PKR1 SGDID:S000004730, Chr XIII from 513593-513961, Genome Release 64-1-1, Verified ORF, "V-ATPase assembly factor, functions with other V-ATPase assembly factors in the ER to efficiently assemble the V-ATPase membrane sector (V0)" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MANFFVRLWESVFEPGTSPQLIIATHVSFVALLLTLIWLIYATNGNIHFYALFCISLLLW
ITVIWFINELSHVKLKDNDELDKDANKKDDSAIKEDSEDKQESGKSTSTARRTQAQSRSR
KA