Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR112C  from Saccharomyces cerevisiae S288C
>YMR112C|YMR112C MED11 SGDID:S000004718, Chr XIII from 494495-494100, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential protein" ORGANISM: Saccharomyces cerevisiae S288C (131 aa)
MQVLNTKSETKQENETMQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESV
KPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDL
LSAILDPSKSK