Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YMR107W  from Saccharomyces cerevisiae S288C
>YMR107W|YMR107W SPG4 SGDID:S000004713, Chr XIII from 483014-483361, Genome Release 64-1-1, Verified ORF, "Protein required for survival at high temperature during stationary phase; not required for growth on nonfermentable carbon sources" ORGANISM: Saccharomyces cerevisiae S288C (115 aa)
MGSFWDAFAVYDKKKHADPSVYGGNHNNTGDSKTQVMFSKEYRQPRTHQQENLQSMRRSS
IGSQDSSDVEDVKEGRLPAEVEIPKNVDISNMSQGEFLRLYESLRRGEPDNKVNR