Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR095C  from Saccharomyces cerevisiae S288C
>YMR095C|YMR095C SNO1 SGDID:S000004701, Chr XIII from 457959-457285, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unconfirmed function, involved in pyridoxine metabolism; expression is induced during stationary phase; forms a putative glutamine amidotransferase complex with Snz1p, with Sno1p serving as the glutaminase" ORGANISM: Saccharomyces cerevisiae S288C (224 aa)
MHKTHSTMSGKSMKVIGVLALQGAFLEHTNHLKRCLAENDYGIKIEIKTVKTPEDLAQCD
ALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTL
GVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYEL
PVNGKDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVSN