Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR077C  from Saccharomyces cerevisiae S288C
>YMR077C|YMR077C VPS20 SGDID:S000004682, Chr XIII from 422149-421484, Genome Release 64-1-1, reverse complement, Verified ORF, "Myristoylated subunit of ESCRTIII, the endosomal sorting complex required for transport of transmembrane proteins into the multivesicular body pathway to the lysosomal/vacuolar lumen; cytoplasmic protein recruited to endosomal membranes" ORGANISM: Saccharomyces cerevisiae S288C (221 aa)
MGQKSSKVHITKTDRAILEVKRSKDEIHKFTRRTDNLILVEKSQLKDLIRKNPENYKSNM
KVRFLLKRIHYQEHLLQQASDQLINLENMVSTLEFKMVEKQFINGLKNGNEILKKLNKEF
SNVDELMDDVQDQIAYQNEINETLSRSLVGTSNYEDDLDKELDALESELNPEKMNNAKVA
NMPSTEGLPSLPQGEQTEQKEREEFATEERSDTKEPLALLS