Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR074C  from Saccharomyces cerevisiae S288C
>YMR074C|YMR074C YMR074C SGDID:S000004678, Chr XIII from 413473-413036, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein with homology to human PDCD5, which is involved in programmed cell death; N-terminal region forms a conserved triple-helix bundle structure; overexpression promotes H2O2-induced apoptosis; YMR074C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MDPELQAIREARLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSR
VALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFERKDF
SEDLNSFDKQNAKNDDDEDDDDFFD