Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR073C  from Saccharomyces cerevisiae S288C
>YMR073C|YMR073C IRC21 SGDID:S000004677, Chr XIII from 412873-412268, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative protein of unknown function; may be involved in resistance to carboplatin and cisplatin; null mutant displays increase in spontaneous Rad52p foci; contains a lipid-binding domain and binds cardiolipin in a large-scale study" ORGANISM: Saccharomyces cerevisiae S288C (201 aa)
MSSDGMNRDVSNSKPNVRFAAPQRLSVAHPAISSPLHMPMSKSSRKPLVRTKIRLDPGHS
ALDWHSLTSNPANYYTKFVSLQLIQDLLDDPVFQKDNFKFSPSQLKNQLLVQKIPLYKIM
PPLRINRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITYFNK
YHQWVNYEKLLQVCFIGVVCE