Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YMR059W  from Saccharomyces cerevisiae S288C
>YMR059W|YMR059W SEN15 SGDID:S000004663, Chr XIII from 391099-391485, Genome Release 64-1-1, Verified ORF, "Subunit of the tRNA splicing endonuclease, which is composed of Sen2p, Sen15p, Sen34p, and Sen54p" ORGANISM: Saccharomyces cerevisiae S288C (128 aa)
MATTDIISLVKNNLLYFQMWTEVEILQDDLSWKGNSLRLLRGRPPHKLSNDVDTEHENSL
SSPRPLEFILPINMSQYKENFLTLECLSQTFTHLCSPSTERILLAIINDDGTIVYYFVYK
GVRKPKRN