Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YMR009W  from Saccharomyces cerevisiae S288C
>YMR009W|YMR009W ADI1 SGDID:S000004611, Chr XIII from 284102-284641, Genome Release 64-1-1, Verified ORF, "Acireductone dioxygenease involved in the methionine salvage pathway; ortholog of human MTCBP-1; transcribed with YMR010W and regulated post-transcriptionally by RNase III (Rnt1p) cleavage; ADI1 mRNA is induced in heat shock conditions" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV
VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES
GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALINQY