Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML129C  from Saccharomyces cerevisiae S288C
>YML129C|YML129C COX14 SGDID:S000004598, Chr XIII from 14753-14541, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial membrane protein, involved in translational regulation of Cox1p and assembly of cytochrome c oxidase (complex IV); associates with complex IV assembly intermediates and complex III/complex IV supercomplexes" ORGANISM: Saccharomyces cerevisiae S288C (70 aa)
MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQ
LQSPTAPPTE