Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML108W  from Saccharomyces cerevisiae S288C
>YML108W|YML108W YML108W SGDID:S000004576, Chr XIII from 54793-55110, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function whose structure defines a new subfamily of the split beta-alpha-beta sandwiches; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; YML108W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF
DAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN