Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML094W  from Saccharomyces cerevisiae S288C
>YML094W|YML094W GIM5 SGDID:S000004559, Chr XIII from 82275-82290,82374-82849, Genome Release 64-1-1, Verified ORF, "Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it" ORGANISM: Saccharomyces cerevisiae S288C (163 aa)
MSSQKIDLTKLNPEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAGNE
GQKLLVPASASLYIPGKIVDNKKFMVDIGTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQ
DIIKEKTQYSLSIEAQIRQAAIRQHEAMSKQQQQQQKKESSTA