>YML081C-A|YML081C-A ATP18 SGDID:S000007247, Chr XIII from 104162-103983, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the mitochondrial F1F0 ATP synthase, which is a large enzyme complex required for ATP synthesis; termed subunit I or subunit j; does not correspond to known ATP synthase subunits in other organisms" ORGANISM: Saccharomyces cerevisiae S288C (59 aa)
MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD