Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML079W  from Saccharomyces cerevisiae S288C
>YML079W|YML079W YML079W SGDID:S000004544, Chr XIII from 110247-110852, Genome Release 64-1-1, Uncharacterized ORF, "Non-essential protein of unknown function with structural resemblance to plant storage and ligand binding proteins (canavalin, glycinin, auxin binding protein) and to some enzymes (epimerase, germin); localizes to the nucleus and cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (201 aa)
MSANVQEAANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEV
EKPVNGGSGNTEMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDG
QVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLK
GEDELKHLVGPEKAAELAFLA